PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00461g10001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family GRAS
Protein Properties Length: 565aa    MW: 63034.8 Da    PI: 4.8782
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00461g10001.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS447.49.3e-1371975653374
                      GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsev 87 
                               + L++cA a+++g+le+a++++++l++++s +gdp++R aay++eALaarla s+++lykal+++e++   ss +l+a++++ ev
  Peinf101Scf00461g10001.1 197 QMLFSCAAAIQDGNLEQASSMINELRQMVSIQGDPLERTAAYMVEALAARLATSGKGLYKALKCKEAP---SSARLSAMQVLLEV 278
                               79*****************************************************************9...9************* PP

                      GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAe 170
                               +P+++f++++aN aIlea++ e+rvHiiDfd++qG Q+ +L+q+Las p++p++l++Tgv++pes+      l+ +g rL+++A+
  Peinf101Scf00461g10001.1 279 CPYFRFGFMAANGAILEAFKDERRVHIIDFDVNQGSQYYTLMQTLASMPGKPAHLKLTGVDDPESVqrAIGGLNVIGLRLEELAK 363
                               ****************************************************************99777789************* PP

                      GRAS 171 elgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFle 255
                                l+++fef++ v+++++ +++ +L+++pgEal+Vn+++qlh+++desvs+ ++rd++L++vksl+Pk+v+vveq++++n+++Fl+
  Peinf101Scf00461g10001.1 364 DLKLSFEFQA-VSSNTALVTPAMLNCRPGEALIVNFAFQLHHMPDESVSTVNQRDQLLRMVKSLNPKLVTVVEQDMNTNTAPFLQ 447
                               **********.7************************************************************************* PP

                      GRAS 256 rflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakll 340
                               r++e  +yysa+f+sl+a+l+r+s+er++vEr++l+r+i n+vaceg+er+er e ++kWr+r+++aGF+p p+s ++++++++l
  Peinf101Scf00461g10001.1 448 RVAEVYNYYSAVFESLDATLSRDSQERVNVERQCLARDIINIVACEGEERIERYEVAGKWRARMMMAGFTPCPISRNVYDSIRSL 532
                               ************************************************************************************* PP

                      GRAS 341 lrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               +++++++ y+ +ee g+l +gW+d++Lv++SaWr
  Peinf101Scf00461g10001.1 533 IKQYSER-YKAKEEAGALHFGWEDKTLVVASAWR 565
                               *****66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.579169546IPR005202Transcription factor GRAS
PfamPF035143.2E-134197565IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 565 aa     Download sequence    Send to blast
MSLVRSARSF GNGKLYFPNG HNENSGLSTS MFTKNARGNL YATESSSTDS YDAKYLLESP  60
SPSEELLNTS PSGVLENPFH QRHSPSFQPS REYNVCHVSY DSEDFVNQSP DSLEYSDGRV  120
TLKLQELERV LFDDNDADGD DEFSHGQSMD VDGEWVNQIR TMLLQDSPKE STSSDSNISS  180
SCSNKEISVT APQTPKQMLF SCAAAIQDGN LEQASSMINE LRQMVSIQGD PLERTAAYMV  240
EALAARLATS GKGLYKALKC KEAPSSARLS AMQVLLEVCP YFRFGFMAAN GAILEAFKDE  300
RRVHIIDFDV NQGSQYYTLM QTLASMPGKP AHLKLTGVDD PESVQRAIGG LNVIGLRLEE  360
LAKDLKLSFE FQAVSSNTAL VTPAMLNCRP GEALIVNFAF QLHHMPDESV STVNQRDQLL  420
RMVKSLNPKL VTVVEQDMNT NTAPFLQRVA EVYNYYSAVF ESLDATLSRD SQERVNVERQ  480
CLARDIINIV ACEGEERIER YEVAGKWRAR MMMAGFTPCP ISRNVYDSIR SLIKQYSERY  540
KAKEEAGALH FGWEDKTLVV ASAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-591975656375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009628410.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_009628411.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_009628412.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_009628413.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_009628414.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016501226.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016501227.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016501228.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016501230.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016501231.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016501232.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLQ00LP30.0Q00LP3_SOLLC; GRAS6
STRINGSolyc04g064550.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA89672429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1